Anti-PPFIBP2 Rabbit Polyclonal Antibody
N° de catalogue ABNOPAB28658
Fournisseur: Abnova
Spécifications
- Type d'anticorps:Primaire
- Nom de l'antigène:PTPRF interacting protein, binding protein 2 (liprin beta 2)
- Symbole de l'antigène:PPFIBP2
- Clonalité:Polyclonal
- Conjugaison:Unconjugated
- Hôte:Rabbit
- ImmunoChimie:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Réactivité:
- Western blot:Yes
- Environmentally Preferable:
- Adsorption croisée:No
- Format:liquid
- ID de gène:8495
- Synonymes antigène:Cclp1
- Storage buffer:PBS, pH 7,2 (40% glycerol, 0,02% sodium azide)
- Sequence:SGATPNGEAAKSPPTICQPDATGSSLLRLRDTESGWDDTAVVNDLSSTSSGTESGPQSPLTPDGKRNPKGIKKFWGKIRRTQSGNFYTDTLGMAEFRRGGL
- Température de stockage:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogène:Recombinant protein corresponding to amino acids of human PPFIBP2.
- Purification:Antigen affinity purification
- Taille:100 μl
- Cdt:100 µl
Spécifications
À propos de cet article
Rabbit polyclonal antibody raised against recombinant PPFIBP2.
Recommended Dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections): 1:50-1:200; Immunofluorescence: 1-4 ?g/ml; Western Blot: 1:100-1:250
Type: Primary
Antigen: PPFIBP2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: