Anti-GCN1 Rabbit Polyclonal Antibody
ABNOPAB21227
: Abnova
- Antibody type:Primary
- Antigen name:GCN1 eIF2 alpha kinase activator homolog
- Antigen symbol:GCN1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Environmentally Preferable:
- Cross adsorption:No
- Format:Liquid
- Gene ID:10985
- Antigen synonyms:GCN1L|GCN1L1|PRIC295
- Storage buffer:PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
- Sequence:ALKEKLGTPDEQLEMANCQAVILSVEDDTGHRIIIEDLLEATRSPEVGMRQAAAIILNIYCSRSKADYTSHLRSLVSGLIRLFNDSSPVVLEESWDALNAITKKLDAGNQLALIEELHKEIRLIGNESKGEHVPGFC
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human GCN1L1.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µl
Rabbit polyclonal antibody raised against recombinant GCN1L1.
Recommended Dilutions: Immunohistochemistry: 1:50-1:200; Immunofluorescence: 1-4 ?g/ml
Type: Primary
Antigen: GCN1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human