Anti-HMX2 Mouse Monoclonal Antibody [clone: 2D2]
Catalog # ABNOH00003167-M09
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:H6 Homeobox 2
- Antigen symbol:HMX2
- Clonality:Monoclonal
- Clone:2D2
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoFluorescence:Yes
- Isotype:IgG2a kappa
- Reactivity:Human
- Environmentally Preferable:
- Cross adsorption:No
- Form:Liquid
- Gene ID:3167
- Antigen synonyms:H6L|Nkx5-2
- Storage buffer:In 1x PBS, pH 7,4
- Sequence:PAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQT
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Shipping temperature:Ice
- Immunogen:HMX2 (NP_005510, 125 a.a. ~ 224 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a full length recombinant HMX2.
Recommended Dilutions: Western Blot (1 - 5 µg/ml)
Type: Primary
Antigen: HMX2
Clonality: Monoclonal
Clone: 2D2
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human